![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) |
![]() | Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species) |
![]() | Species Mouse (Mus musculus), I-AD [TaxId:10090] [54466] (2 PDB entries) |
![]() | Domain d1iaob2: 1iao B:6-93 [38216] Other proteins in same PDB: d1iaoa1, d1iaob1 |
PDB Entry: 1iao (more details), 2.6 Å
SCOP Domain Sequences for d1iaob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iaob2 d.19.1.1 (B:6-93) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AD} hfvvqfkgecyytngtqrirlvtryiynreeyvrydsdvgeyravtelgrpdaeywnsqp eildrtraevdtacrhnyegpetstslr
Timeline for d1iaob2: