![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
![]() | Species Mouse (Mus musculus), I-AD [TaxId:10090] [88829] (2 PDB entries) |
![]() | Domain d2iadb2: 2iad B:5-93 [38214] Other proteins in same PDB: d2iada1, d2iada2, d2iada3, d2iadb1 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2iad (more details), 2.4 Å
SCOPe Domain Sequences for d2iadb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iadb2 d.19.1.1 (B:5-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AD [TaxId: 10090]} rhfvvqfkgecyytngtqrirlvtryiynreeyvrydsdvgeyravtelgrpdaeywnsq peilertraevdtacrhnyegpetstslr
Timeline for d2iadb2: