Lineage for d2iadb2 (2iad B:5-93)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163749Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2163844Species Mouse (Mus musculus), I-AD [TaxId:10090] [88829] (2 PDB entries)
  8. 2163845Domain d2iadb2: 2iad B:5-93 [38214]
    Other proteins in same PDB: d2iada1, d2iada2, d2iada3, d2iadb1

Details for d2iadb2

PDB Entry: 2iad (more details), 2.4 Å

PDB Description: class ii mhc i-ad in complex with an influenza hemagglutinin peptide 126-138
PDB Compounds: (B:) MHC class II I-ad

SCOPe Domain Sequences for d2iadb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iadb2 d.19.1.1 (B:5-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AD [TaxId: 10090]}
rhfvvqfkgecyytngtqrirlvtryiynreeyvrydsdvgeyravtelgrpdaeywnsq
peilertraevdtacrhnyegpetstslr

SCOPe Domain Coordinates for d2iadb2:

Click to download the PDB-style file with coordinates for d2iadb2.
(The format of our PDB-style files is described here.)

Timeline for d2iadb2: