Lineage for d6rk3a2 (6rk3 A:64-127)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400242Species Staphylococcus aureus [TaxId:1280] [382136] (1 PDB entry)
  8. 2400243Domain d6rk3a2: 6rk3 A:64-127 [382137]
    Other proteins in same PDB: d6rk3a1
    automated match to d1ueba2

Details for d6rk3a2

PDB Entry: 6rk3 (more details)

PDB Description: solution structure of the ribosome elongation factor p (ef-p) from staphylococcus aureus
PDB Compounds: (A:) elongation factor P

SCOPe Domain Sequences for d6rk3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rk3a2 b.40.4.0 (A:64-127) automated matches {Staphylococcus aureus [TaxId: 1280]}
mienrrmqylyadgdnhvfmdnesfeqtelssdylkeelnylkegmevqiqtyegetigv
elpk

SCOPe Domain Coordinates for d6rk3a2:

Click to download the PDB-style file with coordinates for d6rk3a2.
(The format of our PDB-style files is described here.)

Timeline for d6rk3a2: