Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (2 proteins) this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain |
Protein automated matches [379561] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [382099] (5 PDB entries) |
Domain d6p9qa1: 6p9q A:1-262 [382125] Other proteins in same PDB: d6p9qa2 automated match to d2jf2a_ complexed with dms, o5p, po4, u20 |
PDB Entry: 6p9q (more details), 1.7 Å
SCOPe Domain Sequences for d6p9qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p9qa1 b.81.1.1 (A:1-262) automated matches {Escherichia coli [TaxId: 562]} midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela etypevkaftdffarstrglir
Timeline for d6p9qa1: