SCOPe 2.08: Domain d6p9qa1: 6p9q A:1-262

Lineage for d6p9qa1 (6p9q A:1-262)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (2 proteins)
   this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain

6. Protein automated matches [379561] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [382099] (5 PDB entries)

8. Domain d6p9qa1: 6p9q A:1-262 [382125]
   Other proteins in same PDB: d6p9qa2
   automated match to d2jf2a_
   complexed with dms, o5p, po4, u20

Details for d6p9qa1

PDB Entry: 6p9q, 1.7 Å

PDB Description: e.coli lpxa in complex with udp-3-o-(r-3-hydroxymyristoyl)-glcnac and compound 2

PDB Compounds: (A:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d6p9qa1:

Sequence; same for both SEQRES and ATOM records:

>d6p9qa1 b.81.1.1 (A:1-262) automated matches {Escherichia coli [TaxId: 562]}
midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn
eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin
ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd
vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela
etypevkaftdffarstrglir

Timeline for d6p9qa1:

• d6p9qa1 first appeared in SCOPe 2.07