Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (14 species) not a true protein |
Species Escherichia coli [TaxId:562] [186874] (4 PDB entries) |
Domain d6ppeg_: 6ppe G: [382121] Other proteins in same PDB: d6ppe1_, d6ppe2_, d6ppe3_, d6ppeo_, d6ppep_, d6ppeq_, d6pper_, d6ppes_, d6ppet_, d6ppeu_, d6ppev_, d6ppex_, d6ppey_, d6ppez_ automated match to d1yg6a_ |
PDB Entry: 6ppe (more details), 3.19 Å
SCOPe Domain Sequences for d6ppeg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ppeg_ c.14.1.1 (G:) automated matches {Escherichia coli [TaxId: 562]} lvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyl yinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmi hqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeave yglvdsilthrn
Timeline for d6ppeg_:
View in 3D Domains from other chains: (mouse over for more information) d6ppe1_, d6ppe2_, d6ppe3_, d6ppea_, d6ppeb_, d6ppec_, d6pped_, d6ppee_, d6ppef_, d6ppeh_, d6ppei_, d6ppej_, d6ppek_, d6ppel_, d6ppem_, d6ppen_, d6ppeo_, d6ppep_, d6ppeq_, d6pper_, d6ppes_, d6ppet_, d6ppeu_, d6ppev_, d6ppex_, d6ppey_, d6ppez_ |