Lineage for d1iebc2 (1ieb C:1-81)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31290Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)
  7. 31357Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (2 PDB entries)
  8. 31364Domain d1iebc2: 1ieb C:1-81 [38211]
    Other proteins in same PDB: d1ieba1, d1iebb1, d1iebc1, d1iebd1

Details for d1iebc2

PDB Entry: 1ieb (more details), 2.7 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1iebc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iebc2 d.19.1.1 (C:1-81) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

SCOP Domain Coordinates for d1iebc2:

Click to download the PDB-style file with coordinates for d1iebc2.
(The format of our PDB-style files is described here.)

Timeline for d1iebc2: