Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) |
Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species) |
Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (2 PDB entries) |
Domain d1iebc2: 1ieb C:1-81 [38211] Other proteins in same PDB: d1ieba1, d1iebb1, d1iebc1, d1iebd1 |
PDB Entry: 1ieb (more details), 2.7 Å
SCOP Domain Sequences for d1iebc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iebc2 d.19.1.1 (C:1-81) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK} ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal aniavdkanldvmkersnntp
Timeline for d1iebc2: