SCOPe 2.08: Domain d1iebc2: 1ieb C:1-81

Lineage for d1iebc2 (1ieb C:1-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries)

8. Domain d1iebc2: 1ieb C:1-81 [38211]
   Other proteins in same PDB: d1ieba1, d1iebb1, d1iebb2, d1iebc1, d1iebd1, d1iebd2
   complexed with nag, so4
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1iebc2

PDB Entry: 1ieb, 2.7 Å

PDB Description: histocompatibility antigen

PDB Compounds: (C:) MHC class II I-ek

SCOPe Domain Sequences for d1iebc2:

Sequence; same for both SEQRES and ATOM records:

>d1iebc2 d.19.1.1 (C:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

Timeline for d1iebc2:

• d1iebc2 first appeared (with stable ids) in SCOP 1.55
  
• d1iebc2 appears in SCOPe 2.07