Lineage for d1iebb2 (1ieb B:4-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938478Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (10 PDB entries)
  8. 2938494Domain d1iebb2: 1ieb B:4-92 [38210]
    Other proteins in same PDB: d1ieba1, d1ieba2, d1iebb1, d1iebc1, d1iebc2, d1iebd1
    contains covalently bound peptides at the N-termini of chains B and D
    complexed with nag, so4

    fragment; missing more than one-third of the common structure and/or sequence

Details for d1iebb2

PDB Entry: 1ieb (more details), 2.7 Å

PDB Description: histocompatibility antigen
PDB Compounds: (B:) MHC class II I-ek

SCOPe Domain Sequences for d1iebb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iebb2 d.19.1.1 (B:4-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvp

SCOPe Domain Coordinates for d1iebb2:

Click to download the PDB-style file with coordinates for d1iebb2.
(The format of our PDB-style files is described here.)

Timeline for d1iebb2: