Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d6lz9l2: 6lz9 L:108-213 [382088] Other proteins in same PDB: d6lz9b_, d6lz9h_, d6lz9l1 automated match to d1h3pl2 |
PDB Entry: 6lz9 (more details), 2.8 Å
SCOPe Domain Sequences for d6lz9l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lz9l2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d6lz9l2: