Class g: Small proteins [56992] (100 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) automatically mapped to Pfam PF02748 |
Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein) |
Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species) |
Species Escherichia coli [TaxId:562] [57828] (62 PDB entries) Uniprot P00478 |
Domain d6kj8d2: 6kj8 D:101-153 [382081] Other proteins in same PDB: d6kj8b1, d6kj8d1, d6kj8f1 automated match to d2atcb2 complexed with zn; mutant |
PDB Entry: 6kj8 (more details), 3.01 Å
SCOPe Domain Sequences for d6kj8d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kj8d2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]} eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan
Timeline for d6kj8d2:
View in 3D Domains from other chains: (mouse over for more information) d6kj8b1, d6kj8b2, d6kj8f1, d6kj8f2 |