SCOPe 2.04: Domain d1iead2: 1iea D:4-92

Lineage for d1iead2 (1iea D:4-92)

Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries)

Domain d1iead2: 1iea D:4-92 [38208]
Other proteins in same PDB: d1ieaa1, d1ieaa2, d1ieab1, d1ieac1, d1ieac2, d1iead1
contains covalently bound peptides at the N-termini of chains B and D
complexed with nag

Details for d1iead2

PDB Entry: 1iea (more details), 2.3 Å

PDB Description: histocompatibility antigen

PDB Compounds: (D:) MHC class II I-ek

SCOPe Domain Sequences for d1iead2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iead2 d.19.1.1 (D:4-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvp

SCOPe Domain Coordinates for d1iead2:

Click to download the PDB-style file with coordinates for d1iead2.
(The format of our PDB-style files is described here.)

Timeline for d1iead2: