Lineage for d6i82b_ (6i82 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)
  8. 2985966Domain d6i82b_: 6i82 B: [382073]
    Other proteins in same PDB: d6i82a2
    automated match to d3b2tb_
    complexed with cl, edo, fmt, h6w

Details for d6i82b_

PDB Entry: 6i82 (more details), 2.05 Å

PDB Description: crystal structure of partially phosphorylated ret v804m tyrosine kinase domain complexed with pdd00018412
PDB Compounds: (B:) proto-oncogene tyrosine-protein kinase receptor ret

SCOPe Domain Sequences for d6i82b_:

Sequence, based on SEQRES records: (download)

>d6i82b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpkwefprknlvlgktlgegefgkvvkatafhlkgragyttvavkmlkenaspselrdll
sefnvlkqvnhphviklygacsqdgplllimeyakygslrgflresrkvgpgylgsggsr
nsssldhpderaltmgdlisfawqisqgmqylaemklvhrdlaarnilvaegrkmkisdf
glsrdvyeedsyvkrsqgripvkwmaieslfdhiyttqsdvwsfgvllweivtlggnpyp
gipperlfnllktghrmerpdncseemyrlmlqcwkqepdkrpvfadiskdlekmmvkr

Sequence, based on observed residues (ATOM records): (download)

>d6i82b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpkwefprknlvlgktlgegefgkvvkatafhlkgragyttvavkmlkenaspselrdll
sefnvlkqvnhphviklygacsqdgplllimeyakygslrgflresrkvgpgylgderal
tmgdlisfawqisqgmqylaemklvhrdlaarnilvaegrkmkisdfglsrdvyeedsyv
krsqgripvkwmaieslfdhiyttqsdvwsfgvllweivtlggnpypgipperlfnllkt
ghrmerpdncseemyrlmlqcwkqepdkrpvfadiskdlekmmvkr

SCOPe Domain Coordinates for d6i82b_:

Click to download the PDB-style file with coordinates for d6i82b_.
(The format of our PDB-style files is described here.)

Timeline for d6i82b_: