Lineage for d1ieac2 (1iea C:1-81)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78785Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (10 species)
  7. 78859Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (5 PDB entries)
  8. 78870Domain d1ieac2: 1iea C:1-81 [38207]
    Other proteins in same PDB: d1ieaa1, d1ieab1, d1ieac1, d1iead1

Details for d1ieac2

PDB Entry: 1iea (more details), 2.3 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1ieac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ieac2 d.19.1.1 (C:1-81) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

SCOP Domain Coordinates for d1ieac2:

Click to download the PDB-style file with coordinates for d1ieac2.
(The format of our PDB-style files is described here.)

Timeline for d1ieac2: