Lineage for d1ieab2 (1iea B:4-92)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545431Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2545542Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (10 PDB entries)
  8. 2545554Domain d1ieab2: 1iea B:4-92 [38206]
    Other proteins in same PDB: d1ieaa1, d1ieaa2, d1ieab1, d1ieac1, d1ieac2, d1iead1
    contains covalently bound peptides at the N-termini of chains B and D
    complexed with nag

Details for d1ieab2

PDB Entry: 1iea (more details), 2.3 Å

PDB Description: histocompatibility antigen
PDB Compounds: (B:) MHC class II I-ek

SCOPe Domain Sequences for d1ieab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ieab2 d.19.1.1 (B:4-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvp

SCOPe Domain Coordinates for d1ieab2:

Click to download the PDB-style file with coordinates for d1ieab2.
(The format of our PDB-style files is described here.)

Timeline for d1ieab2: