Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) contains a single copy of this fold and an extra beta-strand at the C-terminus |
Family d.129.2.0: automated matches [254315] (1 protein) not a true family |
Protein automated matches [254722] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [316258] (14 PDB entries) |
Domain d6uo6b4: 6uo6 B:422-562 [382053] Other proteins in same PDB: d6uo6a1, d6uo6a2, d6uo6a3, d6uo6a5, d6uo6b1, d6uo6b2, d6uo6b3, d6uo6b5 automated match to d5jn5a4 complexed with mg, so4 |
PDB Entry: 6uo6 (more details), 2.15 Å
SCOPe Domain Sequences for d6uo6b4:
Sequence, based on SEQRES records: (download)
>d6uo6b4 d.129.2.0 (B:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]} qnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd gsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlaplis ialkvsqlqertgrtaptvit
>d6uo6b4 d.129.2.0 (B:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]} qnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd gsisrnqglrliftdgsrivfrlsgatirlyidsyekdvakinqdpqvmlaplisialkv sqlqertgrtaptvit
Timeline for d6uo6b4: