SCOPe 2.07: Domain d6vlob1: 6vlo B:1-317

Lineage for d6vlob1 (6vlo B:1-317)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [381972] (1 PDB entry)

8. Domain d6vlob1: 6vlo B:1-317 [382019]
   Other proteins in same PDB: d6vloa2, d6vlob2
   automated match to d1kvsa_
   complexed with nad, ni, tyd

Details for d6vlob1

PDB Entry: 6vlo, 2.05 Å

PDB Description: x-ray structure of the r141 sugar 4,6-dehydratase from acanthamoeba polyphaga minivirus

PDB Compounds: (B:) Putative dTDP-D-glucose 4,6-dehydratase

SCOPe Domain Sequences for d6vlob1:

Sequence; same for both SEQRES and ATOM records:

>d6vlob1 c.2.1.0 (B:1-317) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
mknilvtgglgfigsnfvnhisskydnvniyvydigdycasvenvewnnrtklikgdirn
fdlimhtlteheidtivhfaahshvdnsfknslaftetnvfgthvllecsrmygklklff
hmstdevygeidttdtsrevsllcptnpyaatkagaehivksyflsyklpiiiarcnnvy
grnqypeklipkficslldgkklhiqgtgnsrrnfihaidvadavdlvinngvigetyni
gvtnehsvldvaqilcdiagvnlenqleyvpdrlfndfrynitndkikslgweqsrkdfk
kelvelfdwykvnrhry

Timeline for d6vlob1:

• d6vlob1 is new in SCOPe 2.07-stable
  
• d6vlob1 appears in the current release, SCOPe 2.08