Lineage for d6uo6a4 (6uo6 A:422-562)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975429Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2975468Family d.129.2.0: automated matches [254315] (1 protein)
    not a true family
  6. 2975469Protein automated matches [254722] (4 species)
    not a true protein
  7. 2975473Species Human (Homo sapiens) [TaxId:9606] [316258] (14 PDB entries)
  8. 2975478Domain d6uo6a4: 6uo6 A:422-562 [382014]
    Other proteins in same PDB: d6uo6a1, d6uo6a2, d6uo6a3, d6uo6a5, d6uo6b1, d6uo6b2, d6uo6b3, d6uo6b5
    automated match to d5jn5a4
    complexed with mg, so4

Details for d6uo6a4

PDB Entry: 6uo6 (more details), 2.15 Å

PDB Description: crystal structure of the r422q missense variant of human pgm1
PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d6uo6a4:

Sequence, based on SEQRES records: (download)

>d6uo6a4 d.129.2.0 (A:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

Sequence, based on observed residues (ATOM records): (download)

>d6uo6a4 d.129.2.0 (A:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsagatirlyidsyekdvakinqdpqvmlaplisialk
vsqlqertgrtaptvit

SCOPe Domain Coordinates for d6uo6a4:

Click to download the PDB-style file with coordinates for d6uo6a4.
(The format of our PDB-style files is described here.)

Timeline for d6uo6a4: