Lineage for d6vkga_ (6vkg A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2420908Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2422112Protein automated matches [190681] (2 species)
    not a true protein
  7. 2422122Species Human (Homo sapiens) [TaxId:9606] [187805] (54 PDB entries)
  8. 2422140Domain d6vkga_: 6vkg A: [382002]
    automated match to d4r5aa_
    complexed with bbj, so4, zn

Details for d6vkga_

PDB Entry: 6vkg (more details), 1.37 Å

PDB Description: human carbonic anhydrase ix mimic with epacadostat bound
PDB Compounds: (A:) human carbonic anhydrase IX mimic

SCOPe Domain Sequences for d6vkga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vkga_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdvdkalqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
lpesldywtypgslttpplaegvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

SCOPe Domain Coordinates for d6vkga_:

Click to download the PDB-style file with coordinates for d6vkga_.
(The format of our PDB-style files is described here.)

Timeline for d6vkga_: