SCOP 1.65: Domain d1iakb2: 1iak B:5-92

Lineage for d1iakb2 (1iak B:5-92)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (13 species)

7. Species Mouse (Mus musculus), I-AK [TaxId:10090] [88826] (3 PDB entries)

8. Domain d1iakb2: 1iak B:5-92 [38200]
   Other proteins in same PDB: d1iaka1, d1iaka2, d1iakb1
   complexed with nag

Details for d1iakb2

PDB Entry: 1iak, 1.9 Å

PDB Description: histocompatibility antigen i-ak

SCOP Domain Sequences for d1iakb2:

Sequence; same for both SEQRES and ATOM records:

>d1iakb2 d.19.1.1 (B:5-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AK}
gsfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeywnkq
ylertraeldtvcrhnyektetptslr

Timeline for d1iakb2:

• d1iakb2 first appeared (with stable ids) in SCOP 1.55
  
• d1iakb2 appears in SCOP 1.63
  
• d1iakb2 appears in SCOP 1.67
  
• d1iakb2 appears in the current release, SCOPe 2.08