SCOP 1.55: Domain d1iakb2: 1iak B:5-92

Lineage for d1iakb2 (1iak B:5-92)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)

6. Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)

7. Species Mouse (Mus musculus), I-AK [TaxId:10090] [54464] (2 PDB entries)

8. Domain d1iakb2: 1iak B:5-92 [38200]
   Other proteins in same PDB: d1iaka1, d1iakb1

Details for d1iakb2

PDB Entry: 1iak, 1.9 Å

PDB Description: histocompatibility antigen i-ak

SCOP Domain Sequences for d1iakb2:

Sequence; same for both SEQRES and ATOM records:

>d1iakb2 d.19.1.1 (B:5-92) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AK}
gsfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeywnkq
ylertraeldtvcrhnyektetptslr

Timeline for d1iakb2:

• d1iakb2 appears in SCOP 1.57
  
• d1iakb2 appears in the current release, SCOPe 2.08