Lineage for d6vw1e_ (6vw1 E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616505Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 2616506Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 2616507Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
    part of PfamB PB000266
  6. 2616508Protein Spike protein S1 [143589] (4 species)
  7. 2616509Species Bat sars-like coronavirus [TaxId:1508227] [381993] (1 PDB entry)
  8. 2616510Domain d6vw1e_: 6vw1 E: [381994]
    Other proteins in same PDB: d6vw1a_, d6vw1b_
    automated match to d2dd8s1
    complexed with bma, cl, edo, nag, zn

Details for d6vw1e_

PDB Entry: 6vw1 (more details), 2.68 Å

PDB Description: structure of sars-cov-2 chimeric receptor-binding domain complexed with its receptor human ace2
PDB Compounds: (E:) 2019-nCoV chimeric RBD

SCOPe Domain Sequences for d6vw1e_:

Sequence, based on SEQRES records: (download)

>d6vw1e_ d.318.1.1 (E:) automated matches {Bat sars-like coronavirus [TaxId: 1508227]}
nlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfs
nvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyky
rlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvvl
sfellnapatvcgp

Sequence, based on observed residues (ATOM records): (download)

>d6vw1e_ d.318.1.1 (E:) automated matches {Bat sars-like coronavirus [TaxId: 1508227]}
nlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfs
nvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyky
rlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvvl
sfellnaptvcgp

SCOPe Domain Coordinates for d6vw1e_:

Click to download the PDB-style file with coordinates for d6vw1e_.
(The format of our PDB-style files is described here.)

Timeline for d6vw1e_: