Lineage for d6um8b1 (6um8 B:57-209)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886113Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. 2886283Protein automated matches [190209] (5 species)
    not a true protein
  7. 2886284Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (69 PDB entries)
  8. 2886411Domain d6um8b1: 6um8 B:57-209 [381990]
    Other proteins in same PDB: d6um8b2
    automated match to d3vq9c_
    protein/DNA complex; protein/RNA complex; complexed with 1pe, peg, qcg, so4

Details for d6um8b1

PDB Entry: 6um8 (more details), 2.33 Å

PDB Description: hiv integrase in complex with compound-14
PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d6um8b1:

Sequence, based on SEQRES records: (download)

>d6um8b1 c.55.3.2 (B:57-209) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacewagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d6um8b1 c.55.3.2 (B:57-209) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacewagikqefgviesmnkelkkiigqvrdqaehlktavqmavfihnk
krkgysagerivdiiatdiq

SCOPe Domain Coordinates for d6um8b1:

Click to download the PDB-style file with coordinates for d6um8b1.
(The format of our PDB-style files is described here.)

Timeline for d6um8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6um8b2
View in 3D
Domains from other chains:
(mouse over for more information)
d6um8a_