Lineage for d1iaka2 (1iak A:1-81)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255498Species Mouse (Mus musculus), I-AK [TaxId:10090] [54464] (3 PDB entries)
  8. 255499Domain d1iaka2: 1iak A:1-81 [38199]
    Other proteins in same PDB: d1iaka1, d1iakb1

Details for d1iaka2

PDB Entry: 1iak (more details), 1.9 Å

PDB Description: histocompatibility antigen i-ak

SCOP Domain Sequences for d1iaka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaka2 d.19.1.1 (A:1-81) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AK}
ieadhvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfepqgg
lqniatgkhnleiltkrsnstp

SCOP Domain Coordinates for d1iaka2:

Click to download the PDB-style file with coordinates for d1iaka2.
(The format of our PDB-style files is described here.)

Timeline for d1iaka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iaka1