SCOP 1.73: Domain d1d5xb2: 1d5x B:1-92

Lineage for d1d5xb2 (1d5x B:1-92)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (12 PDB entries)

8. Domain d1d5xb2: 1d5x B:1-92 [38198]
   Other proteins in same PDB: d1d5xa1, d1d5xa2, d1d5xb1, d1d5xc1, d1d5xc2
   complexed with ace, haq

Details for d1d5xb2

PDB Entry: 1d5x, 2.45 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with dipeptide mimetic and seb

PDB Compounds: (B:) protein (hla class II histocompatibility antigen)

SCOP Domain Sequences for d1d5xb2:

Sequence; same for both SEQRES and ATOM records:

>d1d5xb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaey
wnsqkdlleqkraavdtycrhnygvgesftvq

Timeline for d1d5xb2:

• d1d5xb2 first appeared (with stable ids) in SCOP 1.55
  
• d1d5xb2 appears in SCOP 1.71
  
• d1d5xb2 appears in SCOP 1.75
  
• d1d5xb2 appears in the current release, SCOPe 2.08