Lineage for d1d5xb2 (1d5x B:1-92)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31290Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)
  7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [54463] (4 PDB entries)
  8. 31337Domain d1d5xb2: 1d5x B:1-92 [38198]
    Other proteins in same PDB: d1d5xa1, d1d5xb1, d1d5xc1, d1d5xc2

Details for d1d5xb2

PDB Entry: 1d5x (more details), 2.45 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with dipeptide mimetic and seb

SCOP Domain Sequences for d1d5xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5xb2 d.19.1.1 (B:1-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
gdtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaey
wnsqkdlleqkraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1d5xb2:

Click to download the PDB-style file with coordinates for d1d5xb2.
(The format of our PDB-style files is described here.)

Timeline for d1d5xb2: