SCOPe 2.08: Domain d6ulub2: 6ulu B:114-215

Lineage for d6ulub2 (6ulu B:114-215)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily)
   2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix

4. Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (2 families)

5. Family e.37.1.0: automated matches [381345] (1 protein)
   not a true family

6. Protein automated matches [381346] (1 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [381347] (9 PDB entries)

8. Domain d6ulub2: 6ulu B:114-215 [381953]
   Other proteins in same PDB: d6ulua1, d6ulua3, d6ulub1, d6ulub3
   automated match to d1pjqa3
   complexed with cl, sah

Details for d6ulub2

PDB Entry: 6ulu, 2.76 Å

PDB Description: d104a/s128a s. typhimurium siroheme synthase

PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d6ulub2:

Sequence; same for both SEQRES and ATOM records:

>d6ulub2 e.37.1.0 (B:114-215) automated matches {Salmonella typhimurium [TaxId: 90371]}
psiidrsplmvavsaggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmg
errrfwekffvndrlaqslanadekavnatterlfsepldhr

Timeline for d6ulub2:

• d6ulub2 first appeared in SCOPe 2.07