SCOPe 2.06: Domain d1d5zb2: 1d5z B:1-92

Lineage for d1d5zb2 (1d5z B:1-92)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (9 PDB entries)

8. Domain d1d5zb2: 1d5z B:1-92 [38194]
   Other proteins in same PDB: d1d5za1, d1d5za2, d1d5zb1, d1d5zc1, d1d5zc2

Details for d1d5zb2

PDB Entry: 1d5z, 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb

PDB Compounds: (B:) protein (hla class II histocompatibility antigen)

SCOPe Domain Sequences for d1d5zb2:

Sequence; same for both SEQRES and ATOM records:

>d1d5zb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaey
wnsqkdlleqkraavdtycrhnygvgesftvq

Timeline for d1d5zb2:

• d1d5zb2 first appeared (with stable ids) in SCOP 1.55
  
• d1d5zb2 appears in SCOPe 2.05
  
• d1d5zb2 appears in SCOPe 2.07
  
• d1d5zb2 appears in the current release, SCOPe 2.08