Lineage for d1d5zb2 (1d5z B:1-92)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78785Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (10 species)
  7. 78829Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [54463] (4 PDB entries)
  8. 78833Domain d1d5zb2: 1d5z B:1-92 [38194]
    Other proteins in same PDB: d1d5za1, d1d5zb1, d1d5zc1, d1d5zc2

Details for d1d5zb2

PDB Entry: 1d5z (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb
PDB Compounds: (B:)

SCOP Domain Sequences for d1d5zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5zb2 d.19.1.1 (B:1-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
gdtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaey
wnsqkdlleqkraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1d5zb2:

Click to download the PDB-style file with coordinates for d1d5zb2.
(The format of our PDB-style files is described here.)

Timeline for d1d5zb2: