SCOPe 2.07: Domain d6tiwa1: 6tiw A:1-245

Lineage for d6tiwa1 (6tiw A:1-245)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries)

8. Domain d6tiwa1: 6tiw A:1-245 [381938]
   Other proteins in same PDB: d6tiwa2, d6tiwb2
   automated match to d5fnva1
   complexed with g2p, mg, mzk

Details for d6tiwa1

PDB Entry: 6tiw, 1.09 Å

PDB Description: human kinesin-5 motor domain in the gsk state bound to microtubules (conformation 2)

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6tiwa1:

Sequence; same for both SEQRES and ATOM records:

>d6tiwa1 c.32.1.1 (A:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d6tiwa1:

• d6tiwa1 is new in SCOPe 2.07-stable
  
• d6tiwa1 appears in the current release, SCOPe 2.08