![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein automated matches [226905] (13 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (15 PDB entries) |
![]() | Domain d6t23d2: 6t23 D:147-375 [381928] Other proteins in same PDB: d6t23a1, d6t23b1, d6t23c1, d6t23d1, d6t23e1 automated match to d1c0fa2 complexed with 9zk, adp, mg, po4 |
PDB Entry: 6t23 (more details), 3.1 Å
SCOPe Domain Sequences for d6t23d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6t23d2 c.55.1.1 (D:147-375) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf
Timeline for d6t23d2: