Lineage for d6t23d2 (6t23 D:147-375)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2884130Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (15 PDB entries)
  8. 2884151Domain d6t23d2: 6t23 D:147-375 [381928]
    Other proteins in same PDB: d6t23a1, d6t23b1, d6t23c1, d6t23d1, d6t23e1
    automated match to d1c0fa2
    complexed with 9zk, adp, mg, po4

Details for d6t23d2

PDB Entry: 6t23 (more details), 3.1 Å

PDB Description: cryo-em structure of jasplakinolide-stabilized f-actin (aged)
PDB Compounds: (D:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6t23d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t23d2 c.55.1.1 (D:147-375) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

SCOPe Domain Coordinates for d6t23d2:

Click to download the PDB-style file with coordinates for d6t23d2.
(The format of our PDB-style files is described here.)

Timeline for d6t23d2: