Lineage for d1d5mb2 (1d5m B:2-92)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409679Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 409721Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (5 PDB entries)
  8. 409722Domain d1d5mb2: 1d5m B:2-92 [38192]
    Other proteins in same PDB: d1d5ma1, d1d5ma2, d1d5mb1, d1d5mc1, d1d5mc2
    complexed with ace, nag

Details for d1d5mb2

PDB Entry: 1d5m (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb

SCOP Domain Sequences for d1d5mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5mb2 d.19.1.1 (B:2-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4}
dtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeyw
nsqkdlleqkraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1d5mb2:

Click to download the PDB-style file with coordinates for d1d5mb2.
(The format of our PDB-style files is described here.)

Timeline for d1d5mb2: