Lineage for d1d5mb2 (1d5m B:2-92)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (9 PDB entries)
  8. Domain d1d5mb2: 1d5m B:2-92 [38192]
    Other proteins in same PDB: d1d5ma1, d1d5ma2, d1d5mb1, d1d5mc1, d1d5mc2
    complexed with nag
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1d5mb2

PDB Entry: 1d5m (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb
PDB Compounds: (B:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1d5mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5mb2 d.19.1.1 (B:2-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
dtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeyw
nsqkdlleqkraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1d5mb2 are not available.

Timeline for d1d5mb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d5mb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1d5ma1, d1d5ma2, d1d5mc1, d1d5mc2