Lineage for d1d5ma2 (1d5m A:4-81)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31290Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)
  7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [54463] (4 PDB entries)
  8. Domain d1d5ma2: 1d5m A:4-81 [38191]
    Other proteins in same PDB: d1d5ma1, d1d5mb1, d1d5mc1, d1d5mc2

Details for d1d5ma2

PDB Entry: 1d5m (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb
PDB Compounds: (A:)

SCOP Domain Sequences for d1d5ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5ma2 d.19.1.1 (A:4-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOP Domain Coordinates for d1d5ma2 are not available.

Timeline for d1d5ma2:

Domains from same chain:
(mouse over for more information)
d1d5ma1
Domains from other chains:
(mouse over for more information)
d1d5mb1, d1d5mb2, d1d5mc1, d1d5mc2