Lineage for d1a6ab2 (1a6a B:5-92)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255458Species Human (Homo sapiens), HLA-DR3 [TaxId:9606] [54462] (1 PDB entry)
  8. 255460Domain d1a6ab2: 1a6a B:5-92 [38190]
    Other proteins in same PDB: d1a6aa1, d1a6ab1
    complexed with nag

Details for d1a6ab2

PDB Entry: 1a6a (more details), 2.75 Å

PDB Description: the structure of an intermediate in class ii mhc maturation: clip bound to hla-dr3

SCOP Domain Sequences for d1a6ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6ab2 d.19.1.1 (B:5-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR3}
prfleystsechffngtervryldryfhnqeenvrfdsdvgefravtelgrpdaeywnsq
kdlleqkrgrvdnycrhnygvvesftvq

SCOP Domain Coordinates for d1a6ab2:

Click to download the PDB-style file with coordinates for d1a6ab2.
(The format of our PDB-style files is described here.)

Timeline for d1a6ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a6ab1