Lineage for d6t7xa2 (6t7x A:127-247)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583764Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2583765Protein automated matches [226907] (28 species)
    not a true protein
  7. 2583981Species Pyrococcus abyssi [TaxId:272844] [381883] (2 PDB entries)
  8. 2583983Domain d6t7xa2: 6t7x A:127-247 [381891]
    Other proteins in same PDB: d6t7xa3
    automated match to d5a6da2

Details for d6t7xa2

PDB Entry: 6t7x (more details), 2.3 Å

PDB Description: crystal structure of pcna from p. abyssi
PDB Compounds: (A:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d6t7xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t7xa2 d.131.1.0 (A:127-247) automated matches {Pyrococcus abyssi [TaxId: 272844]}
elpftakvvilgdvikeavkdaslvsdsmkfiakeneftmraegetqevevkltledegl
ldievqeetksaygisylsdmvkglgkadevtikfgnempmqmeyyirdegrlifllapr
v

SCOPe Domain Coordinates for d6t7xa2:

Click to download the PDB-style file with coordinates for d6t7xa2.
(The format of our PDB-style files is described here.)

Timeline for d6t7xa2: