Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Pyrococcus abyssi [TaxId:272844] [381883] (2 PDB entries) |
Domain d6t7xa2: 6t7x A:127-247 [381891] Other proteins in same PDB: d6t7xa3 automated match to d5a6da2 |
PDB Entry: 6t7x (more details), 2.3 Å
SCOPe Domain Sequences for d6t7xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6t7xa2 d.131.1.0 (A:127-247) automated matches {Pyrococcus abyssi [TaxId: 272844]} elpftakvvilgdvikeavkdaslvsdsmkfiakeneftmraegetqevevkltledegl ldievqeetksaygisylsdmvkglgkadevtikfgnempmqmeyyirdegrlifllapr v
Timeline for d6t7xa2: