Lineage for d1a6aa2 (1a6a A:5-81)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183231Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2183292Species Human (Homo sapiens), HLA-DR3 [TaxId:9606] [88810] (1 PDB entry)
  8. 2183293Domain d1a6aa2: 1a6a A:5-81 [38189]
    Other proteins in same PDB: d1a6aa1, d1a6ab1, d1a6ab2
    complexed with nag

Details for d1a6aa2

PDB Entry: 1a6a (more details), 2.75 Å

PDB Description: the structure of an intermediate in class ii mhc maturation: clip bound to hla-dr3
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1a6aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6aa2 d.19.1.1 (A:5-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR3 [TaxId: 9606]}
hviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalania
vdkanleimtkrsnytp

SCOPe Domain Coordinates for d1a6aa2:

Click to download the PDB-style file with coordinates for d1a6aa2.
(The format of our PDB-style files is described here.)

Timeline for d1a6aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a6aa1