Lineage for d1a6aa2 (1a6a A:5-81)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31290Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)
  7. 31326Species Human (Homo sapiens), HLA-DR3 [TaxId:9606] [54462] (1 PDB entry)
  8. 31327Domain d1a6aa2: 1a6a A:5-81 [38189]
    Other proteins in same PDB: d1a6aa1, d1a6ab1

Details for d1a6aa2

PDB Entry: 1a6a (more details), 2.75 Å

PDB Description: the structure of an intermediate in class ii mhc maturation: clip bound to hla-dr3

SCOP Domain Sequences for d1a6aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6aa2 d.19.1.1 (A:5-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR3}
hviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalania
vdkanleimtkrsnytp

SCOP Domain Coordinates for d1a6aa2:

Click to download the PDB-style file with coordinates for d1a6aa2.
(The format of our PDB-style files is described here.)

Timeline for d1a6aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a6aa1