SCOP 1.55: Domain d1a6aa2: 1a6a A:5-81

Lineage for d1a6aa2 (1a6a A:5-81)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)

6. Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)

7. Species Human (Homo sapiens), HLA-DR3 [TaxId:9606] [54462] (1 PDB entry)

8. Domain d1a6aa2: 1a6a A:5-81 [38189]
   Other proteins in same PDB: d1a6aa1, d1a6ab1

Details for d1a6aa2

PDB Entry: 1a6a, 2.75 Å

PDB Description: the structure of an intermediate in class ii mhc maturation: clip bound to hla-dr3

SCOP Domain Sequences for d1a6aa2:

Sequence; same for both SEQRES and ATOM records:

>d1a6aa2 d.19.1.1 (A:5-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR3}
hviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalania
vdkanleimtkrsnytp

Timeline for d1a6aa2:

• d1a6aa2 appears in SCOP 1.57
  
• d1a6aa2 appears in the current release, SCOPe 2.08