Lineage for d1hqrb2 (1hqr B:202-292)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406673Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1406713Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
    Uniprot P04229 30-219
  8. 1406727Domain d1hqrb2: 1hqr B:202-292 [38188]
    Other proteins in same PDB: d1hqra1, d1hqra2, d1hqrb1, d1hqrd1, d1hqrd2
    complexed with zn

Details for d1hqrb2

PDB Entry: 1hqr (more details), 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii
PDB Compounds: (B:) hla-dr beta chain

SCOPe Domain Sequences for d1hqrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqrb2 d.19.1.1 (B:202-292) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
dtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaeyw
nsqkdfledrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1hqrb2:

Click to download the PDB-style file with coordinates for d1hqrb2.
(The format of our PDB-style files is described here.)

Timeline for d1hqrb2: