SCOPe 2.08: Domain d6riva1: 6riv A:1-84

Lineage for d6riva1 (6riv A:1-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Alopecurus myosuroides [TaxId:81473] [381852] (1 PDB entry)

8. Domain d6riva1: 6riv A:1-84 [381865]
   Other proteins in same PDB: d6riva2, d6rivb2
   automated match to d1axda2
   complexed with gol, gs8, na, sin

Details for d6riva1

PDB Entry: 6riv, 1.33 Å

PDB Description: crystal structure of alopecurus myosuroides gstf

PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d6riva1:

Sequence; same for both SEQRES and ATOM records:

>d6riva1 c.47.1.0 (A:1-84) automated matches {Alopecurus myosuroides [TaxId: 81473]}
mapvkvfgpamstnvarvtlcleevgaeyevvnidfntmehkspehlarnpfgqipafqd
gdlllwesraiskyvlrkyktdev

Timeline for d6riva1:

• d6riva1 first appeared in SCOPe 2.07