Lineage for d6qp3a_ (6qp3 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504457Species Bacillus subtilis [TaxId:224308] [320074] (12 PDB entries)
  8. 2504466Domain d6qp3a_: 6qp3 A: [381860]
    automated match to d4dgta_
    complexed with act, plp

Details for d6qp3a_

PDB Entry: 6qp3 (more details), 2.3 Å

PDB Description: crystal structure of the plp-bound c-s lyase from bacillus subtilis (strain 168)
PDB Compounds: (A:) Cystathionine beta-lyase PatB

SCOPe Domain Sequences for d6qp3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qp3a_ c.67.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
mnfdkreerlgtqsvkwdktgelfgvtdalpmwvadmdfrapeaitealkerldhgifgy
ttpdqktkdavcgwmqnrhgwkvnpesitfspgvvtalsmavqaftepgdqvvvqppvyt
pfyhmvekngrhilhnpllekdgayaidfedletklsdpsvtlfilcnphnpsgrswsre
dllklgelclehgvtvvsdeihsdlmlyghkhtpfaslsddfadisvtcaapsktfniag
lqasaiiipdrlkrakfsaslqrnglgglnafavtaieaayskggpwldelityieknmn
eaeaflstelpkvkmmkpdasyliwldfsayglsdaelqqrmlkkgkvilepgtkygpgg
egfmrlnagcslatlqdglrrikaals

SCOPe Domain Coordinates for d6qp3a_:

Click to download the PDB-style file with coordinates for d6qp3a_.
(The format of our PDB-style files is described here.)

Timeline for d6qp3a_: