SCOPe 2.08: Domain d1bx2e2: 1bx2 E:3-92

Lineage for d1bx2e2 (1bx2 E:3-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
   Uniprot P04229 30-219

8. Domain d1bx2e2: 1bx2 E:3-92 [38186]
   Other proteins in same PDB: d1bx2a1, d1bx2a2, d1bx2b1, d1bx2d1, d1bx2d2, d1bx2e1
   complexed with nag
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1bx2e2

PDB Entry: 1bx2, 2.6 Å

PDB Description: crystal structure of hla-dr2 (dra*0101,drb1*1501) complexed with a peptide from human myelin basic protein

PDB Compounds: (E:) protein (hla-dr2)

SCOPe Domain Sequences for d1bx2e2:

Sequence; same for both SEQRES and ATOM records:

>d1bx2e2 d.19.1.1 (E:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn
sqkdileqaraavdtycrhnygvvesftvq

Timeline for d1bx2e2:

• d1bx2e2 first appeared (with stable ids) in SCOP 1.55
  
• d1bx2e2 appears in SCOPe 2.07