SCOPe 2.04: Domain d1bx2d2: 1bx2 D:2-81

Lineage for d1bx2d2 (1bx2 D:2-81)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)

8. Domain d1bx2d2: 1bx2 D:2-81 [38185]
   Other proteins in same PDB: d1bx2a1, d1bx2b1, d1bx2b2, d1bx2d1, d1bx2e1, d1bx2e2
   complexed with nag

Details for d1bx2d2

PDB Entry: 1bx2, 2.6 Å

PDB Description: crystal structure of hla-dr2 (dra*0101,drb1*1501) complexed with a peptide from human myelin basic protein

PDB Compounds: (D:) protein (hla-dr2)

SCOPe Domain Sequences for d1bx2d2:

Sequence; same for both SEQRES and ATOM records:

>d1bx2d2 d.19.1.1 (D:2-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
niavdkanleimtkrsnytp

Timeline for d1bx2d2:

• d1bx2d2 first appeared (with stable ids) in SCOP 1.55
  
• d1bx2d2 appears in SCOPe 2.03
  
• d1bx2d2 appears in SCOPe 2.05
  
• d1bx2d2 appears in the current release, SCOPe 2.08