Lineage for d6rjnd_ (6rjn D:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2620683Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2620684Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2620685Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2620841Protein automated matches [190051] (12 species)
    not a true protein
  7. 2621013Species Komagataella pastoris [TaxId:4922] [381812] (1 PDB entry)
  8. 2621017Domain d6rjnd_: 6rjn D: [381834]
    automated match to d2xq1j_
    complexed with cl, gol, hem, k, na, ndp, peg, so4

Details for d6rjnd_

PDB Entry: 6rjn (more details), 2.3 Å

PDB Description: crystal structure of a fungal catalase at 2.3 angstroms
PDB Compounds: (D:) catalase

SCOPe Domain Sequences for d6rjnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rjnd_ e.5.1.1 (D:) automated matches {Komagataella pastoris [TaxId: 4922]}
qppkwttsngapvsdvfateratfdnanhannapkvgplllqdfqlidslahfdreripe
rvvhakgagafgefevtddisdvcaakfldtigkktriftrfstvggekgsadsardprg
fstkfyteegnldlvynntpiffirdpskfphfihtqkrnpatnlkdanmfwdylvnnqe
sihqvmylfsdrgtpaslrkmngysghtykwynkkgewvyvqvhfksdlgvvnfnneeag
klagedpdyhtgdlfnaiergeypswtcyiqtmtqeqaakqpfsvfdltkvwphkdfplr
rfgkftlnenpknyfaeveqaafspshtipsmqpsadpvlqsrlfsypdthrhrlgvnyq
qipvncpvapvftpqmrdgsmtvngnlgstpnykssfcpfsteaqiqtnshtpeevlaah
tekfhwggildsksydfeqpralwkvfgktpgqqrnfchnvavhvaaanheiqdrvfeyf
skvypeigdqirkevlqlsprg

SCOPe Domain Coordinates for d6rjnd_:

Click to download the PDB-style file with coordinates for d6rjnd_.
(The format of our PDB-style files is described here.)

Timeline for d6rjnd_: