SCOPe 2.05: Domain d1fv1e2: 1fv1 E:1-92

Lineage for d1fv1e2 (1fv1 E:1-92)

Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
Uniprot P04229 30-219
Domain d1fv1e2: 1fv1 E:1-92 [38182]
Other proteins in same PDB: d1fv1a1, d1fv1a2, d1fv1b1, d1fv1d1, d1fv1d2, d1fv1e1
complexed with gol, so4

Details for d1fv1e2

PDB Entry: 1fv1 (more details), 1.9 Å

PDB Description: structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two hla-dr2 alleles

PDB Compounds: (E:) major histocompatibility complex beta chain

SCOPe Domain Sequences for d1fv1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv1e2 d.19.1.1 (E:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaey
wnsqkdfledrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1fv1e2:

Click to download the PDB-style file with coordinates for d1fv1e2.
(The format of our PDB-style files is described here.)

Timeline for d1fv1e2: