Lineage for d6rjnb_ (6rjn B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015076Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 3015077Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 3015078Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 3015234Protein automated matches [190051] (11 species)
    not a true protein
  7. 3015396Species Komagataella pastoris [TaxId:4922] [381812] (1 PDB entry)
  8. 3015398Domain d6rjnb_: 6rjn B: [381815]
    automated match to d2xq1j_
    complexed with cl, gol, hem, k, na, ndp, peg, so4

Details for d6rjnb_

PDB Entry: 6rjn (more details), 2.3 Å

PDB Description: crystal structure of a fungal catalase at 2.3 angstroms
PDB Compounds: (B:) catalase

SCOPe Domain Sequences for d6rjnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rjnb_ e.5.1.1 (B:) automated matches {Komagataella pastoris [TaxId: 4922]}
qppkwttsngapvsdvfateratfdnanhannapkvgplllqdfqlidslahfdreripe
rvvhakgagafgefevtddisdvcaakfldtigkktriftrfstvggekgsadsardprg
fstkfyteegnldlvynntpiffirdpskfphfihtqkrnpatnlkdanmfwdylvnnqe
sihqvmylfsdrgtpaslrkmngysghtykwynkkgewvyvqvhfksdlgvvnfnneeag
klagedpdyhtgdlfnaiergeypswtcyiqtmtqeqaakqpfsvfdltkvwphkdfplr
rfgkftlnenpknyfaeveqaafspshtipsmqpsadpvlqsrlfsypdthrhrlgvnyq
qipvncpvapvftpqmrdgsmtvngnlgstpnykssfcpfsteaqiqtnshtpeevlaah
tekfhwggildsksydfeqpralwkvfgktpgqqrnfchnvavhvaaanheiqdrvfeyf
skvypeigdqirkevlqlsprg

SCOPe Domain Coordinates for d6rjnb_:

Click to download the PDB-style file with coordinates for d6rjnb_.
(The format of our PDB-style files is described here.)

Timeline for d6rjnb_: