SCOPe 2.04: Domain d1fv1d2: 1fv1 D:4-81

Lineage for d1fv1d2 (1fv1 D:4-81)

Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)
Domain d1fv1d2: 1fv1 D:4-81 [38181]
Other proteins in same PDB: d1fv1a1, d1fv1b1, d1fv1b2, d1fv1d1, d1fv1e1, d1fv1e2
complexed with gol, so4

Details for d1fv1d2

PDB Entry: 1fv1 (more details), 1.9 Å

PDB Description: structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two hla-dr2 alleles

PDB Compounds: (D:) major histocompatibility complex alpha chain

SCOPe Domain Sequences for d1fv1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv1d2 d.19.1.1 (D:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOPe Domain Coordinates for d1fv1d2:

Click to download the PDB-style file with coordinates for d1fv1d2.
(The format of our PDB-style files is described here.)

Timeline for d1fv1d2: