SCOP 1.73: Domain d1fv1b2: 1fv1 B:1-92

Lineage for d1fv1b2 (1fv1 B:1-92)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (12 PDB entries)

8. Domain d1fv1b2: 1fv1 B:1-92 [38180]
   Other proteins in same PDB: d1fv1a1, d1fv1a2, d1fv1b1, d1fv1d1, d1fv1d2, d1fv1e1

Details for d1fv1b2

PDB Entry: 1fv1, 1.9 Å

PDB Description: structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two hla-dr2 alleles

PDB Compounds: (B:) major histocompatibility complex beta chain

SCOP Domain Sequences for d1fv1b2:

Sequence; same for both SEQRES and ATOM records:

>d1fv1b2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaey
wnsqkdfledrraavdtycrhnygvgesftvq

Timeline for d1fv1b2:

• d1fv1b2 first appeared (with stable ids) in SCOP 1.55
  
• d1fv1b2 appears in SCOP 1.71
  
• d1fv1b2 appears in SCOP 1.75
  
• d1fv1b2 appears in the current release, SCOPe 2.08