Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [320074] (13 PDB entries) |
Domain d6qp3d_: 6qp3 D: [381797] automated match to d4dgta_ complexed with act, plp |
PDB Entry: 6qp3 (more details), 2.3 Å
SCOPe Domain Sequences for d6qp3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qp3d_ c.67.1.0 (D:) automated matches {Bacillus subtilis [TaxId: 224308]} nfdkreerlgtqsvkwdktgelfgvtdalpmwvadmdfrapeaitealkerldhgifgyt tpdqktkdavcgwmqnrhgwkvnpesitfspgvvtalsmavqaftepgdqvvvqppvytp fyhmvekngrhilhnpllekdgayaidfedletklsdpsvtlfilcnphnpsgrswsred llklgelclehgvtvvsdeihsdlmlyghkhtpfaslsddfadisvtcaapsktfniagl qasaiiipdrlkrakfsaslqrnglgglnafavtaieaayskggpwldelityieknmne aeaflstelpkvkmmkpdasyliwldfsayglsdaelqqrmlkkgkvilepgtkygpgge gfmrlnagcslatlqdglrrikaals
Timeline for d6qp3d_: