Lineage for d1fv1a2 (1fv1 A:3-81)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255447Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [54461] (3 PDB entries)
  8. 255448Domain d1fv1a2: 1fv1 A:3-81 [38179]
    Other proteins in same PDB: d1fv1a1, d1fv1b1, d1fv1d1, d1fv1e1

Details for d1fv1a2

PDB Entry: 1fv1 (more details), 1.9 Å

PDB Description: structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two hla-dr2 alleles
PDB Compounds: (A:)

SCOP Domain Sequences for d1fv1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv1a2 d.19.1.1 (A:3-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOP Domain Coordinates for d1fv1a2:

Click to download the PDB-style file with coordinates for d1fv1a2.
(The format of our PDB-style files is described here.)

Timeline for d1fv1a2: