SCOPe 2.08: Domain d6jl4b2: 6jl4 B:158-326

Lineage for d6jl4b2 (6jl4 B:158-326)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (26 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [226636] (8 PDB entries)

8. Domain d6jl4b2: 6jl4 B:158-326 [381771]
   Other proteins in same PDB: d6jl4b3, d6jl4c3, d6jl4d3, d6jl4e3
   automated match to d4iv5a2
   complexed with asp, cp, ncd, po4

Details for d6jl4b2

PDB Entry: 6jl4, 2.4 Å

PDB Description: crystal structure of aspartate transcarbamoylase from trypanosoma cruzi in complex with carbamoyl aspartate (ca) and phosphate (pi)

PDB Compounds: (B:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d6jl4b2:

Sequence, based on SEQRES records:

>d6jl4b2 c.78.1.0 (B:158-326) automated matches {Trypanosoma cruzi [TaxId: 353153]}
svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk
gviihrthaltdevmqksdvlyttrlqkerfmastsddaaalqsfaakaditidaarmrl
akekmivmhplprndelsttvdadpraayfrqmrygmfmrmailwsvla

Sequence, based on observed residues (ATOM records):

>d6jl4b2 c.78.1.0 (B:158-326) automated matches {Trypanosoma cruzi [TaxId: 353153]}
svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk
gviihrthaltdevmqksdvlyttrlqkddaaalqsfaakaditidaarmrlakekmivm
hplprndelsttvdadpraayfrqmrygmfmrmailwsvla

Timeline for d6jl4b2:

• d6jl4b2 first appeared in SCOPe 2.07